Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: Q71UI9
RecName: Histone H2A.V
Begin-End: 18-94
Organism: Homo sapiens
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
VSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDL
KVKRITPRHLQLAIRGD
Structures of the domain Q71UI9 18-94
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3waa X-ray 3.2 G 18-93  H-Bb S-Bb L-Bb 
3waa X-ray 3.2 C 17-93  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2019

text