Pfam domain
Pfam family: RNA_pol_L (PF01193.23)
Uniprot AC: Q72I32
RecName: DNA-directed RNA polymerase subunit alpha
Begin-End: 26-222
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
EPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKEL
VVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVD
RGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSV
TPLEALNQAVEILREHL
Structures of the domain Q72I32 26-222
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5voi X-ray 2.8 B 26-222 None
5voi X-ray 2.8 A 26-222 None


© NPIDB team 2003 - 2019

text