Pfam domain
Pfam family: RNA_pol_A_bac (PF01000.25)
Uniprot AC: Q72I32
RecName: DNA-directed RNA polymerase subunit alpha
Begin-End: 52-180
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
AVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKA
RDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVF
SPVRRVAFQ
Structures of the domain Q72I32 52-180
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5voi X-ray 2.8 B 59-154 None
5voi X-ray 2.8 A 59-154 None


© NPIDB team 2003 - 2019

text