Pfam domain
Pfam family: Put_DNA-bind_N (PF06971.12)
Uniprot AC: Q72I39
RecName: Redox-sensing transcriptional repressor Rex
Begin-End: 2-50
Organism: Thermus thermophilus
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
KVPEAAISRLITYLRILEELEAQGVHRTSSEQLGELAQVTAFQVRKDLS
Structures of the domain Q72I39 2-50
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3ikt X-ray 2.26 A 2-50  H-Bb H-Mj L-Bb L-Mj 
3ikt X-ray 2.26 B 2-50  H-Bb H-Mj L-Bb 
3il2 X-ray 2.49 A 2-50 None
3il2 X-ray 2.49 B 2-50 None


© NPIDB team 2003 - 2019

text