Pfam domain
Pfam family: Sigma70_r2 (PF04542.13)
Uniprot AC: Q72L95
RecName: RNA polymerase sigma factor SigA
Begin-End: 187-257
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
LIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQA
INRAIADQART
Structures of the domain Q72L95 187-257
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5x21 X-ray 3.32 F 187-256 None
5x22 X-ray 3.35 F 187-256 None
5x22 X-ray 3.35 P 187-256 None


© NPIDB team 2003 - 2019

text