Pfam domain
Pfam family: Sigma70_r4 (PF04545.15)
Uniprot AC: Q72L95
RecName: RNA polymerase sigma factor SigA
Begin-End: 357-410
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
ALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQIENKALRKLKY
Structures of the domain Q72L95 357-410
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5x21 X-ray 3.32 F 357-409 None
5x22 X-ray 3.35 P 357-409 None


© NPIDB team 2003 - 2019

text