Pfam domain
Pfam family: Sigma70_r4 (PF04545.18)
Uniprot AC: Q72L95
RecName: RNA polymerase sigma factor SigA
Begin-End: 357-410
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
ALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQIENKALRKLKY
Structures of the domain Q72L95 357-410
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6oy5 X-ray 3.1 F 357-410 None
5x21 X-ray 3.32 F 357-410 None
6p70 X-ray 3.05 F 357-410 None
6cuu X-ray 2.99 F 357-410 None
6ow3 X-ray 2.77 F 357-410 None
6p71 X-ray 2.92 F 357-410 None
5x22 X-ray 3.35 P 357-410 None
6oy7 X-ray 3.04 F 357-410 None
6ovy X-ray 3 F 357-410 None
6oy6 X-ray 3.1 F 357-410 None


© NPIDB team 2003 - 2021

text