Pfam domain
Pfam family: MerR_1 (PF13411.8)
Uniprot AC: Q746J7
RecName: Probable transcriptional regulator
Begin-End: 7-77
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
YTIAEVEAMTGLSAEVLRQWERRYGFPKPRRTPGGHRLYSAEDVEALKTIKRWLEEGATP
KAAIRRYLAQE
Structures of the domain Q746J7 7-77
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5c8e X-ray 3.89 B 7-77  H-Bb H-Mj L-Bb 
5c8e X-ray 3.89 C 7-77  H-Bb H-Mj S-Bb 
5c8e X-ray 3.89 A 7-77  S-Bb 
5c8e X-ray 3.89 E 7-77  S-Bb 
5c8e X-ray 3.89 F 7-77  L-Bb L-Mj 
5c8e X-ray 3.89 G 7-77  H-Bb H-Mj S-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2021

text