Pfam domain
Pfam family: Ago_PAZ (PF18309.3)
Uniprot AC: Q746M7
RecName: Uncharacterized protein
Begin-End: 181-263
Organism: Thermus thermophilus
Interaction Mode:  S-Bb 

Sequence:
AWLAQGHPLPKRVRNAYDRRTWELLRLGEEDPKELPLPGGLSLLDYHASKGRLQGREGGR
VAWVADPKDPRKPIPHLTGLLVP
Structures of the domain Q746M7 181-263
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3hk2 X-ray 2.8 A 181-263 None
3hk2 X-ray 2.8 B 181-263 None
4nca X-ray 2.49 B 181-263  S-Bb 
4nca X-ray 2.49 A 181-263  S-Bb 
3dlb X-ray 2.7 A 181-263 None
3dlb X-ray 2.7 B 181-263 None
3hxm X-ray 3.1 A 181-272 None
3f73 X-ray 3 B 181-263 None
3f73 X-ray 3 A 181-263 None
3hm9 X-ray 3.3 A 181-263 None
3ho1 X-ray 2.6 A 181-263 None
3dlh X-ray 3 B 181-263 None
3dlh X-ray 3 A 181-263 None
3hvr X-ray 3.21 A 181-263 None
3hvr X-ray 3.21 B 181-263 None
5gq9 X-ray 2.7 B 181-263 None
5xpa X-ray 2.9 A 181-263 None
4kpy X-ray 2.41 A 181-263  S-Bb 
4kpy X-ray 2.41 B 181-263  S-Bb 
4ncb X-ray 2.19 B 181-263  S-Bb 
4ncb X-ray 2.19 A 181-263  S-Bb 
5xow X-ray 2.9 A 181-263 None
3hjf X-ray 3.06 A 181-263 None
4n76 X-ray 2.89 B 181-263  S-Bb 
5xq2 X-ray 3.33 B 181-263  S-Bb 
5xq2 X-ray 3.33 A 181-263  S-Bb 
4n41 X-ray 2.25 B 181-263 None
4n41 X-ray 2.25 A 181-263  S-Bb 
4n47 X-ray 2.82 A 181-263 None
5xpg X-ray 2.8 A 181-263 None
5xp8 X-ray 3.1 A 181-263 None


© NPIDB team 2003 - 2021

text