Pfam domain
Pfam family: Piwi (PF02171.16)
Uniprot AC: Q746M7
RecName: Uncharacterized protein
Begin-End: 407-670
Organism: Thermus thermophilus
Interaction Mode:  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 

Sequence:
LVLTPPMAWEDRNRLKALLLREGLPSQILNVPLREEERHRWENALLGLLAKAGLQVVALS
GAYPAELAVGFDAGGRESFRFGGAACAVGGDGGHLLWTLPEAQAGERIPQEVVWDLLEET
LWAFRRKAGRLPSRVLLLRDGRVPQDEFALALEALAREGIAYDLVSVRKSGGGRVYPVQG
RLADGLYVPLEDKTFLLLTVHRDFRGTPRPLKLVHEAGDTPLEALAHQIFHLTRLYPASG
FAFPRLPAPLHLADRLVKEVGRLG
Structures of the domain Q746M7 407-670
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3hk2 X-ray 2.8 A 507-667 None
3hk2 X-ray 2.8 B 506-667 None
3hxm X-ray 3.1 A 427-667 None
3f73 X-ray 3 B 507-667 None
3f73 X-ray 3 A 429-667 None
4kpy X-ray 2.41 A 422-667 None
4kpy X-ray 2.41 B 422-667 None
3hm9 X-ray 3.3 A 426-667 None
3ho1 X-ray 2.6 A 444-667 None
3dlh X-ray 3 B 519-667 None
3dlh X-ray 3 A 519-667 None
3hvr X-ray 3.21 A 447-667 None
3hvr X-ray 3.21 B 507-667 None
5gq9 X-ray 2.7 A 422-667  H-Bb H-Mj H-Mn L-Bb 
5gq9 X-ray 2.7 B 422-667  H-Bb H-Mj H-Mn L-Bb 
5xpa X-ray 2.9 A 422-667 None
4nca X-ray 2.49 A 422-667 None
4nca X-ray 2.49 B 422-667 None
4ncb X-ray 2.19 A 422-667  H-Bb H-Mj H-Mn S-Bb L-Bb 
4ncb X-ray 2.19 B 422-667 None
5xow X-ray 2.9 A 422-667 None
5xou X-ray 2.63 A 422-667 None
5xou X-ray 2.63 B 422-667 None
3hjf X-ray 3.06 A 422-667 None
4n76 X-ray 2.89 A 422-667 None
4n76 X-ray 2.89 B 422-667 None
5xq2 X-ray 3.33 B 422-667  S-Bb L-Bb L-Mn 
5xq2 X-ray 3.33 A 422-667  S-Bb L-Bb L-Mn 
4n41 X-ray 2.25 A 427-667  H-Bb H-Mj H-Mn S-Bb L-Bb 
4n41 X-ray 2.25 B 508-667  H-Bb S-Bb L-Bb L-Mn 
4n47 X-ray 2.82 A 516-667  L-Bb L-Mj 
5xpg X-ray 2.8 A 422-667 None
5xp8 X-ray 3.1 A 422-667 None


© NPIDB team 2003 - 2019

text