Pfam domain
Pfam family: rve (PF00665.25)
Uniprot AC: Q76353
RecName: Integrase (Fragment)
Begin-End: 55-162
Organism: Human immunodeficiency virus 1
Interaction Mode:  H-Bb H-Mj H-Mn L-Bb 

Sequence:
DCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVH
TDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKII
Structures of the domain Q76353 55-162
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5u1c X-ray 3.9 C 59-160  H-Bb H-Mj H-Mn L-Bb 
5u1c X-ray 3.9 D 59-153 None
5u1c X-ray 3.9 B 59-153 None
5u1c X-ray 3.9 A 59-160  H-Bb H-Mj H-Mn L-Bb 


© NPIDB team 2003 - 2019

text