Pfam domain
Pfam family: UDG (PF03167.18)
Uniprot AC: Q76RG8
RecName: Uracil-DNA glycosylase
Begin-End: 74-241
Organism: Human herpesvirus 8
Interaction Mode:   

Sequence:
CCDPEDIKVVILGQDPYHKGQATGLAFSVDPQCQVPPSLRSIFRELEASVPNFSTPSHGC
LDSWARQGVLLLNTVLTVEKGRAGSHEGLGWDWFTSFIISSISSKLEHCVFLLWGRKAID
RTPLINAQKHLVLTAQHPSPLASLGGRHSRWPRFQGCNHFNLANDYLT
Structures of the domain Q76RG8 74-241
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5nnu X-ray 2.97 A 79-242 None
5nnu X-ray 2.97 B 79-242 None
5nnu X-ray 2.97 D 79-242 None
5nnu X-ray 2.97 E 79-242 None


© NPIDB team 2003 - 2020

text