Pfam domain
Pfam family: Phage_integrase (PF00589.24)
Uniprot AC: Q7BP35
RecName: Int protein
Begin-End: 190-386
Organism: Enterococcus faecalis
Interaction Mode:   

Sequence:
PLTPAQEESFLSFIQGDKVYQKHYDAIVILLGTGLRISELCGLTDKDLDFENRVIIVSHQ
LLRNTGVGYYIDEPKTQSGVRKIPMNEEVYQAFQRVIKNRKGAKPFIIDGYANFLFLKQN
GYPMTAVDYGGMFGRLVKKYNKSHEEALPKTTTPHAMRHTFCTRLANAGMNPKALQYIMG
HSNITMTLNYYAHATFD
Structures of the domain Q7BP35 190-386
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6en0 X-ray 2.8 B 190-386 None
6en0 X-ray 2.8 A 190-386 None
6en2 X-ray 2.67 B 190-386 None
6en2 X-ray 2.67 A 190-386 None
6emy X-ray 2.5 A 190-386 None
6emy X-ray 2.5 B 190-386 None
6emz X-ray 2.79 A 190-386 None
6emz X-ray 2.79 B 190-386 None
6en1 X-ray 2.67 B 190-386 None
6en1 X-ray 2.67 A 190-386 None


© NPIDB team 2003 - 2021

text