Pfam domain
Pfam family: Exo_endo_phos (PF03372.22)
Uniprot AC: Q7DD47
RecName: Exodeoxyribonuclease
Begin-End: 5-247
Organism: Neisseria meningitidis serogroup B
Interaction Mode:   

Sequence:
ISANVNGIRSAYKKGFYEYIAASGADIVCVQELKAQEADLSADMKNPHGMHGHWHCAEKR
GYSGVAVYSKRKPDNVQIGMGIEEFDREGRFVRCDFGRLSVISLYLPSGSSAEERQQVKY
RFLDAFYPMLEAMKNEGRDIVVCGDWNIAHQNIDLKNWKGNQKNSGFLPEEREWIGKVIH
KLGWTDMWRTLYPDVPGYTWWSNRGQAYAKDVGWRIDYQMVTPELAAKAVSAHVYKDEKF
SDH
Structures of the domain Q7DD47 5-247
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4b5i X-ray 2.56 A 6-247 None
4b5g X-ray 2.75 A 6-247 None
4b5g X-ray 2.75 B 6-247 None
4b5g X-ray 2.75 C 6-247 None
4b5f X-ray 2.01 A 6-247 None
4b5j X-ray 2.1 A 6-247 None
4b5m X-ray 2.76 A 6-247 None
4b5m X-ray 2.76 B 6-247 None
4b5m X-ray 2.76 C 6-247 None
4b5h X-ray 3.05 A 6-247 None


© NPIDB team 2003 - 2020

text