Pfam domain
Pfam family: Transposase_1 (PF01359.20)
Uniprot AC: Q7JQ07
RecName: Mariner Mos1 transposase
Begin-End: 161-238
Organism: Drosophila mauritiana
Interaction Mode:   

Sequence:
FFVSPKRKKSYVDPGQPATSTARPNRFGKKTMLCVWWDQSGVIYYELLKRGETVNTARYQ
QQLINLNRALQRKRPEYQ
Structures of the domain Q7JQ07 161-238
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3hot X-ray 3.25 B 161-243  H-Bb S-Bb L-Bb 
3hot X-ray 3.25 A 161-243  S-Bb L-Bb L-Mj L-Mn 
5hoo X-ray 3.3 B 161-246  S-Bb L-Bb 
5hoo X-ray 3.3 A 161-246  S-Bb L-Bb 
3hos X-ray 3.5 B 161-244  H-Bb S-Bb L-Bb 
3hos X-ray 3.5 A 161-243  S-Bb L-Bb L-Mj L-Mn 
4r79 X-ray 3.1 A 161-243  S-Bb L-Bb L-Mj L-Mn 
4r79 X-ray 3.1 B 161-243  H-Bb S-Bb L-Bb 
4u7b X-ray 3.09 G 161-240  L-Bb 
4u7b X-ray 3.09 B 161-240  S-Bb L-Bb 
4u7b X-ray 3.09 A 161-240  S-Bb L-Bb 


© NPIDB team 2003 - 2021

text