Pfam domain
Pfam family: Transposase_1 (PF01359.17)
Uniprot AC: Q7JQ07
RecName: Mariner Mos1 transposase
Begin-End: 162-237
Organism: Drosophila mauritiana
Interaction Mode:  H-Bb S-Bb L-Bb L-Mj L-Mn 

Sequence:
FVSPKRKKSYVDPGQPATSTARPNRFGKKTMLCVWWDQSGVIYYELLKRGETVNTARYQQ
QLINLNRALQRKRPEY
Structures of the domain Q7JQ07 162-237
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3hos X-ray 3.5 A 163-236  S-Bb L-Bb 
3hos X-ray 3.5 B 163-237  S-Bb L-Bb 
3hot X-ray 3.25 B 163-237  S-Bb L-Bb 
3hot X-ray 3.25 A 163-236  S-Bb L-Bb 
4u7b X-ray 3.09 A 163-237  S-Bb L-Bb 
4u7b X-ray 3.09 G 163-237  L-Bb 
4u7b X-ray 3.09 A 163-237  L-Bb 
4u7b X-ray 3.09 B 163-237  S-Bb L-Bb 
4r79 X-ray 3.1 A 163-236  S-Bb L-Bb L-Mj L-Mn 
4r79 X-ray 3.1 B 163-236  H-Bb S-Bb L-Bb 
5hoo X-ray 3.3 A 163-244  S-Bb L-Bb 
5hoo X-ray 3.3 B 163-244  S-Bb L-Bb 


© NPIDB team 2003 - 2019

text