Pfam domain
Pfam family: S1 (PF00575.25)
Uniprot AC: Q7KZ85
RecName: Transcription elongation factor SPT6
Begin-End: 1226-1282
Organism: Homo sapiens
Interaction Mode:   

Sequence:
IGVKTRLDNGVTGFIPTKFLSDKVVKRPEERVKVGMTVHCRIMKIDIEKFSADLTCR
Structures of the domain Q7KZ85 1226-1282
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gmh X-ray 3.1 M 1163-1282 None
6ted X-ray 3.1 M 1163-1282 None


© NPIDB team 2003 - 2021

text