Pfam domain
Pfam family: PUA (PF01472.19)
Uniprot AC: Q7LWY0
RecName: Probable tRNA pseudouridine synthase B
Begin-End: 251-324
Organism: Pyrococcus furiosus
Interaction Mode:   

Sequence:
PKVWIKDSAVAAVTHGADLAVPGIAKLHAGIKRGDLVAIMTLKDELVALGKAMMTSQEML
EKTKGIAVDVEKVF
Structures of the domain Q7LWY0 251-324
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2hvy X-ray 2.3 A 254-326 None
3lwr X-ray 2.2 A 254-326 None
3hay X-ray 4.99 A 254-326 None
3lwv X-ray 2.5 A 254-326 None
3lwo X-ray 2.85 A 254-326 None
3lwp X-ray 2.5 A 254-326 None
3lwq X-ray 2.68 A 254-326 None
2rfk X-ray 2.87 A 254-326 None
3hax X-ray 2.11 A 254-326 None
3mqk X-ray 2.8 A 254-326 None
3hjw X-ray 2.35 A 254-326 None
3hjy X-ray 3.65 A 254-326 None


© NPIDB team 2003 - 2019

text