Pfam domain
Pfam family: Endonuclease_1 (PF04231.12)
Uniprot AC: Q7MHK3
RecName: Endonuclease I
Begin-End: 23-228
Organism: Vibrio vulnificus
Interaction Mode:  H-Bb H-Mn L-Bb 

Sequence:
SFSAAKQQAVKIYQDHPISFYCGCDIEWQGKKGIPNLETCGYQVRKQQTRASRIEWEHVV
PAWQFGHHRQCWQKGGRKNCSKNDQQFRLMEADLHNLTPAIGEVNGDRSNFNFSQWNGVD
GVSYGRCEMQVNFKQRKVMPPDRARGSIARTYLYMSQEYGFQLSKQQQQLMQAWNKSYPV
DEWECTRDDRIAKIQGNHNPFVQQSC
Structures of the domain Q7MHK3 23-228
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1oup X-ray 2.3 A 35-227 None
1oup X-ray 2.3 B 35-227 None
2ivk X-ray 2.9 D 35-227 None
2ivk X-ray 2.9 A 35-227  H-Bb L-Bb 
2ivk X-ray 2.9 B 35-227  H-Bb H-Mn L-Bb 
2ivk X-ray 2.9 C 35-227 None


© NPIDB team 2003 - 2020

text