Pfam domain
Pfam family: PHF5 (PF03660.13)
Uniprot AC: Q7RTV0
RecName: PHD finger-like domain-containing protein 5A
Begin-End: 7-95
Organism: Homo sapiens
Interaction Mode:   

Sequence:
DLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGV
SDAYYCKECTIQEKDRDGCPKIVNLGSSK
Structures of the domain Q7RTV0 7-95
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5o9z X-ray 4.5 y 49-96 None


© NPIDB team 2003 - 2019

text