Pfam domain
Pfam family: tRNA-synt_1 (PF00133.21)
Uniprot AC: Q7SIE4
RecName: Leucine--tRNA ligase
Begin-End: 12-175
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
KWQRFWEEKGFMKAKDLPGGRGKQYVLVMFPYPSGDLHMGHLKNYTMGDVLARFRRMQGY
EVLHPMGWDAFGLPAENAALKFGVHPKDWTYANIRQAKESLRLMGILYDWDREVTTCEPE
YYRWNQWIFLKMWEKGLAYRAKGLVNWCPKCQTVLANEQVVEGR
Structures of the domain Q7SIE4 12-175
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2v0g X-ray 3.5 D 13-171 None
2v0g X-ray 3.5 A 13-171 None
2byt X-ray 3.3 A 13-171 None
2byt X-ray 3.3 D 13-171 None
2bte X-ray 2.9 A 13-171 None
2bte X-ray 2.9 D 13-171 None


© NPIDB team 2003 - 2019

text