Pfam domain
Pfam family: Leucyl-specific (PF14795.5)
Uniprot AC: Q7SIE4
RecName: Leucine--tRNA ligase
Begin-End: 580-635
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
WTDFGPVEVEGSVVRLPEPTRIRLEIPESALSLEDVRKMGAELRPHEDGTLHLWKP
Structures of the domain Q7SIE4 580-635
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2v0g X-ray 3.5 D 580-635 None
2v0g X-ray 3.5 A 580-635 None
2byt X-ray 3.3 A 580-635 None
2byt X-ray 3.3 D 580-635 None
2bte X-ray 2.9 A 580-635 None
2bte X-ray 2.9 D 580-635 None


© NPIDB team 2003 - 2019

text