Pfam domain
Pfam family: GTP_EFTU (PF00009.26)
Uniprot AC: Q7Z2Z2
RecName: Elongation factor-like GTPase 1
Begin-End: 17-365
Organism: Homo sapiens
Interaction Mode:   

Sequence:
ANIRNICVLAHVDHGKTTLADCLISSNGIISSRLAGKLRYMDSREDEQIRGITMKSSAIS
LHYATGNEEYLINLIDSPGHVDFSSEVSTAVRICDGCIIVVDAVEGVCPQTQAVLRQAWL
ENIRPVLVINKIDRLIVELKFTPQEAYSHLKNILEQINALTGTLFTSKVLEERAERETES
QVNPNSEQGEQVYDWSTGLEDTDDSHLYFSPEQGNVVFTSAIDGWGFGIEHFARIYSQKI
GIKKEVLMKTLWGDYYINMKAKKIMKGDQAKGKKPLFVQLILENIWSLYDAVLKKDKDKI
DKIVTSLGLKIGAREARHSDPKVQINAICSQWLPISHAVLAMVCQKLPS
Structures of the domain Q7Z2Z2 17-365
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5anb X-ray 4.1 K 18-268 None
5anc X-ray 4.2 K 18-268 None


© NPIDB team 2003 - 2019

text