Pfam domain
Pfam family: EFG_II (PF14492.5)
Uniprot AC: Q7Z2Z2
RecName: Elongation factor-like GTPase 1
Begin-End: 614-687
Organism: Homo sapiens
Interaction Mode:   

Sequence:
ATPIVRVAVEPKHPSEMPQLVKGMKLLNQADPCVQILIQETGEHVLVTAGEVHLQRCLDD
LKERFAKIHISVSE
Structures of the domain Q7Z2Z2 614-687
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5anb X-ray 4.1 K 615-678 None
5anc X-ray 4.2 K 615-678 None


© NPIDB team 2003 - 2019

text