Pfam domain
Pfam family: Ank_2 (PF12796.9)
Uniprot AC: Q7Z6K4
RecName: Notch-regulated ankyrin repeat-containing protein
Begin-End: 18-107
Organism: Homo sapiens
Interaction Mode:   

Sequence:
FQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADI
RLANRDGWSALHIAAFGGHQDIVLYLITKA
Structures of the domain Q7Z6K4 18-107
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6py8 X-ray 3.75 B 18-107 None
6py8 X-ray 3.75 G 18-108 None


© NPIDB team 2003 - 2021

text