Pfam domain
Pfam family: Ribosomal_L10 (PF00466.19)
Uniprot AC: Q7Z7H8
RecName: 39S ribosomal protein L10, mitochondrial
Begin-End: 81-171
Organism: Homo sapiens
Interaction Mode:   

Sequence:
LLRREIAAVFQDNRMIAVCQNVALSAEDKLLMRHQLRKHKILMKVFPNQVLKPFLEDSKY
QNLLPLFVGHNMLLVSEEPKVKEMVRILRTV
Structures of the domain Q7Z7H8 81-171
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j7y X-ray 3.4 I 84-162 None
5oom X-ray 3.03 I 84-162 None


© NPIDB team 2003 - 2019

text