Pfam domain
Pfam family: DNA_alkylation (PF08713.13)
Uniprot AC: Q816E8
RecName: Uncharacterized protein
Begin-End: 8-221
Organism: Bacillus cereus
Interaction Mode:  H-Bb H-Mj H-Mn L-Bb L-Mj 

Sequence:
LQEHFTAHQNPEKAEPMARYMKNHFLFLGIQTPERRQLLKDIIQIHTLPDQKDFQIIIRE
LWDLPEREFQAAALDIMQKYKKHINETHIPFLEELIVTKSWWDSVDSIVPTFLGDIFLKH
PELISAYIPKWIASDNIWLQRAAILFQLKYKQKMDEELLFWIIGQLHSSKEFFIQKAIGW
VLREYAKTNPDVVWEYVQNNELAPLSKREAIKHI
Structures of the domain Q816E8 8-221
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5clc X-ray 1.73 A 8-221  H-Bb H-Mn L-Bb 
5cl9 X-ray 1.54 A 8-221  H-Bb H-Mj H-Mn L-Bb 
5cld X-ray 1.54 A 8-221  H-Bb H-Mj H-Mn L-Bb 
5uuh X-ray 1.57 A 8-221  H-Bb H-Mj H-Mn L-Bb 
3jx7 X-ray 1.6 A 8-221  H-Bb H-Mj H-Mn L-Bb 
3jy1 X-ray 1.75 A 8-221  H-Bb H-Mj H-Mn L-Bb L-Mj 
5cl6 X-ray 1.54 A 8-221  H-Bb H-Mj H-Mn L-Bb 
3jxz X-ray 1.75 A 8-221  H-Bb H-Mj H-Mn L-Bb L-Mj 
3jxy X-ray 1.5 A 8-221  H-Bb H-Mj H-Mn L-Bb 
5uuf X-ray 1.61 A 8-221  H-Bb H-Mj H-Mn L-Bb 
5cl4 X-ray 1.87 A 8-221  H-Bb H-Mj H-Mn L-Bb 
5kub X-ray 1.73 A 8-221  H-Bb H-Mj H-Mn L-Bb 
5cla X-ray 1.54 A 8-221  H-Bb H-Mj H-Mn L-Bb 
5clb X-ray 1.77 A 8-221  H-Bb H-Mj H-Mn L-Bb 
5uug X-ray 1.71 A 8-221  H-Bb H-Mj H-Mn L-Bb 
5cl3 X-ray 1.97 A 8-221  H-Bb H-Mj H-Mn L-Bb 
5cl8 X-ray 1.38 A 8-221  H-Bb H-Mj H-Mn L-Bb 
5cl7 X-ray 1.44 A 8-221  H-Bb H-Mj H-Mn L-Bb 
5cle X-ray 1.73 A 8-221  H-Bb H-Mj H-Mn L-Bb 
5cl5 X-ray 1.57 A 8-221  H-Bb H-Mj H-Mn L-Bb 


© NPIDB team 2003 - 2021

text