Pfam domain
Pfam family: PPV_E2_C (PF00511.16)
Uniprot AC: Q84294
RecName: Regulatory protein E2
Begin-End: 286-363
Organism: Human papillomavirus type 6a
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
PIVQFQGESNCLKCFRYRLNDKHRHLFDLISSTWHWASPKAPHKHAIVTVTYHSEEQRQQ
FLNVVKIPPTIRHKLGFM
Structures of the domain Q84294 286-363
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ayg X-ray 3.1 B 285-360 None
2ayg X-ray 3.1 A 285-360 None
2ayb X-ray 3.2 A 285-360  H-Bb H-Mj L-Bb 
2ayb X-ray 3.2 B 285-360  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2019

text