Pfam domain
Pfam family: Ribosomal_S9 (PF00380.18)
Uniprot AC: Q875N2
RecName: 40S ribosomal protein S16
Begin-End: 11-143
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
GKKKSATAVAHVKAGKGLIKVNGSPITLVQPEILRFKVYEPLLLVGLDKFANIDIRVKVT
GGGHVSQVYAIRQAIAKGLVAYHQKFVDEQSKNELKKAFTSYDRTLLIADSRRPEPKKFG
GRGARSRFQKSYR
Structures of the domain Q875N2 11-143
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5it9 X-ray 3.8 Q 11-143 None
3j80 X-ray 3.75 Q 11-143 None
3jam X-ray 3.46 Q 11-143 None
3jaq X-ray 6 Q 11-143 None
3j81 X-ray 4 Q 11-143 None
3jap X-ray 4.9 Q 11-143 None


© NPIDB team 2003 - 2019

text