Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: Q8CGP4
RecName: Histone H2A
Begin-End: 15-91
Organism: Mus musculus
Interaction Mode:  H-Bb S-Bb S-Mn L-Bb 

Sequence:
VKSRSSRAGLQFPVGRVHRLLRQGNYAQRIGAGAPVYLAAVLEYLTAEVLELAGNAARDN
KKTRITPRHLQLAIRND
Structures of the domain Q8CGP4 15-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3x1u X-ray 3.25 G 15-88  H-Bb S-Bb L-Bb 
3x1u X-ray 3.25 C 16-88  H-Bb S-Bb L-Bb 
3x1t X-ray 2.81 G 16-88  H-Bb S-Bb S-Mn L-Bb 
3x1t X-ray 2.81 C 16-88  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2019

text