Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: Q8CGP6
RecName: Histone H2A type 1-H
Begin-End: 15-91
Organism: Mus musculus
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
AKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDN
KKTRIIPRHLQLAIRND
Structures of the domain Q8CGP6 15-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2f8n X-ray 2.9 K 18-88  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2019

text