Pfam domain
Pfam family: Put_DNA-bind_N (PF06971.12)
Uniprot AC: Q8E565
RecName: Redox-sensing transcriptional repressor Rex
Begin-End: 6-54
Organism: Streptococcus agalactiae serotype III
Interaction Mode:  H-Bb H-Mj 

Sequence:
SIPKATAKRLSLYYRIFKRFNTDGIEKASSKQIADALGIDSATVRRDFS
Structures of the domain Q8E565 6-54
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3ket X-ray 2.4 A 7-54  H-Bb H-Mj 


© NPIDB team 2003 - 2019

text