Pfam domain
Pfam family: HTH_3 (PF01381.21)
Uniprot AC: Q8GGH0
RecName: Regulatory protein
Begin-End: 13-67
Organism: Enterobacter sp. RFL1396
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mj 

Sequence:
IKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLTIKSLELIMKGLEVSDVVF
Structures of the domain Q8GGH0 13-67
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4x4h X-ray 2.8 A 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
4x4h X-ray 2.8 D 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
4x4h X-ray 2.8 C 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
4x4h X-ray 2.8 B 13-63  H-Bb H-Mj S-Bb L-Bb 
4x4b X-ray 2.8 A 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
4x4b X-ray 2.8 B 13-63  H-Bb H-Mj S-Bb L-Bb 
4x4b X-ray 2.8 C 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
4x4b X-ray 2.8 D 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
4ivz X-ray 3.1 F 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
4ivz X-ray 3.1 E 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
4ivz X-ray 3.1 B 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
4ivz X-ray 3.1 A 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
3clc X-ray 2.8 D 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
3clc X-ray 2.8 C 13-63  H-Bb H-Mj S-Bb L-Mj 
3clc X-ray 2.8 B 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
3clc X-ray 2.8 A 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
3s8q X-ray 2.1 B 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
3s8q X-ray 2.1 A 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
4x4d X-ray 2.8 D 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
4x4d X-ray 2.8 A 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
4x4d X-ray 2.8 B 13-63  H-Bb H-Mj S-Bb L-Bb 
4x4d X-ray 2.8 C 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
4i8t X-ray 3 A 13-63  H-Bb 
4i8t X-ray 3 B 13-63 None
4iwr X-ray 2.4 B 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
4iwr X-ray 2.4 A 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
4iwr X-ray 2.4 E 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
4iwr X-ray 2.4 F 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
3ufd X-ray 2.8 E 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
3ufd X-ray 2.8 F 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
3ufd X-ray 2.8 A 13-63 None
3ufd X-ray 2.8 B 13-63 None
4x4i X-ray 2.8 D 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
4x4i X-ray 2.8 C 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
4x4i X-ray 2.8 B 13-63  H-Bb H-Mj S-Bb L-Bb 
4x4i X-ray 2.8 A 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
4x4e X-ray 2.8 D 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
4x4e X-ray 2.8 C 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
4x4e X-ray 2.8 B 13-63  H-Bb H-Mj S-Bb L-Bb 
4x4e X-ray 2.8 A 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
4x4f X-ray 2.8 D 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
4x4f X-ray 2.8 C 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
4x4f X-ray 2.8 B 13-63  H-Bb H-Mj S-Bb L-Bb 
4x4f X-ray 2.8 A 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
4x4c X-ray 2.8 D 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
4x4c X-ray 2.8 C 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
4x4c X-ray 2.8 B 13-63  H-Bb H-Mj S-Bb L-Bb 
4x4c X-ray 2.8 A 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
4x4g X-ray 2.8 D 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
4x4g X-ray 2.8 C 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 
4x4g X-ray 2.8 B 13-63  H-Bb H-Mj S-Bb L-Bb 
4x4g X-ray 2.8 A 13-63  H-Bb H-Mj S-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2019

text