Pfam domain
Pfam family: Pre-SET (PF05033.15)
Uniprot AC: Q8GZB6
RecName: Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH4
Begin-End: 336-438
Organism: Arabidopsis thaliana
Interaction Mode:   

Sequence:
ISGGLEFKGIPATNRVDDSPVSPTSGFTYIKSLIIEPNVIIPKSSTGCNCRGSCTDSKKC
ACAKLNGGNFPYVDLNDGRLIESRDVVFECGPHCGCGPKCVNR
Structures of the domain Q8GZB6 336-438
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4qen X-ray 2 A 337-438 None
4qep X-ray 3.1 A 337-438 None
4qeo X-ray 2 A 337-438 None


© NPIDB team 2003 - 2019

text