Pfam domain
Pfam family: Ribosomal_S4 (PF00163.18)
Uniprot AC: Q8I3R0
RecName: 40S ribosomal protein S9, putative
Begin-End: 2-106
Organism: Plasmodium falciparum (isolate 3D7)
Interaction Mode:   

Sequence:
PKSYRNYSKTARNPKRPFEKERLDQELKLIGEYGLKNKREIWRVQYLLAKIRSAARYLLT
LDEKSSKRIFQGEALLRRMVRQGLLGENEEKLDYVLGLTLPKLLE
Structures of the domain Q8I3R0 2-106
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j7a X-ray 3.2 E 12-62 None


© NPIDB team 2003 - 2019

text