Pfam domain
Pfam family: Ribosomal_S17e (PF00833.17)
Uniprot AC: Q8I502
RecName: 40S ribosomal protein S17, putative
Begin-End: 3-110
Organism: Plasmodium falciparum (isolate 3D7)
Interaction Mode:   

Sequence:
RVRTKTIKRAARQIVEKYYAKLTLDFQINKKITEEVAIIPSKRMKNKVAGFVTHLMKRIQ
KGPVRGISLKLQEEERERRLDFVPEKSQIDVSVIYVEPDTLRMIKSLG
Structures of the domain Q8I502 3-110
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j7a X-ray 3.2 W 3-98 None


© NPIDB team 2003 - 2019

text