Pfam domain
Pfam family: Ribosomal_S9 (PF00380.18)
Uniprot AC: Q8IAX5
RecName: 40S ribosomal protein S16, putative
Begin-End: 12-143
Organism: Plasmodium falciparum (isolate 3D7)
Interaction Mode:   

Sequence:
GKKKTAVAVATVTNGKGLIKLNGKNLDLVEPYILKTKVYEPLWLIGSGKLKNLDIRIRVK
GGGQTSQIYAIRQAIGKGIISYYQKYVDESTKKELKDVLLRYDRSLLVGDTRRCEPKKFG
GKGARARYQKSY
Structures of the domain Q8IAX5 12-143
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j7a X-ray 3.2 M 12-143 None


© NPIDB team 2003 - 2019

text