Pfam domain
Pfam family: AP2 (PF00847.19)
Uniprot AC: Q8IKH2
RecName: Transcription factor with AP2 domain(S)
Begin-End: 64-119
Organism: Plasmodium falciparum (isolate 3D7)
Interaction Mode:   

Sequence:
SGYPGVSWNKRMCAWLAFFYDGASRRSRTFHPKHFNMDKEKARLAAVEFMKTVENN
Structures of the domain Q8IKH2 64-119
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3igm X-ray 2.2 B 64-118 None
3igm X-ray 2.2 A 64-116 None


© NPIDB team 2003 - 2019

text