Pfam domain
Pfam family: RNase_T (PF00929.23)
Uniprot AC: Q8IV48
RecName: 3'-5' exoribonuclease 1
Begin-End: 131-306
Organism: Homo sapiens
Interaction Mode:   

Sequence:
CIIDFEATCEEGNPPEFVHEIIEFPVVLLNTHTLEIEDTFQQYVRPEINTQLSDFCISLT
GITQDQVDRADTFPQVLKKVIDWMKLKELGTKYKYSLLTDGSWDMSKFLNIQCQLSRLKY
PPFAKKWINIRKSYGNFYKVPRSQTKLTIMLEKLGMDYDGRPHCGLDDSKNIARIA
Structures of the domain Q8IV48 131-306
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4qoz X-ray 2.3 E 132-305 None
4qoz X-ray 2.3 B 132-305 None
1zbh X-ray 3 C 132-305 None
1zbh X-ray 3 A 132-305 None
1zbh X-ray 3 B 132-305 None
1zbh X-ray 3 D 132-305 None
4l8r X-ray 2.6 E 132-305 None
4l8r X-ray 2.6 B 132-305 None


© NPIDB team 2003 - 2019

text