Pfam domain
Pfam family: B3 (PF02362.20)
Uniprot AC: Q8L7G0
RecName: Auxin response factor 1
Begin-End: 124-226
Organism: Arabidopsis thaliana
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj L-Mn 

Sequence:
FCKTLTASDTSTHGGFSVLRRHADDCLPPLDMSQQPPWQELVATDLHNSEWHFRHIFRGQ
PRRHLLTTGWSVFVSSKKLVAGDAFIFLRGENEELRVGVRRHM
Structures of the domain Q8L7G0 124-226
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4ldx X-ray 2.9 B 124-225  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
4ldx X-ray 2.9 A 124-225  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2019

text