Pfam domain
Pfam family: RNA_pol (PF00940.18)
Uniprot AC: Q8LTE3
RecName: RNAP2
Begin-End: 4-154
Organism: Enterobacteria phage N4
Interaction Mode:   

Sequence:
FTAREYLKIDIANNYGLDKEDWDDRIAWFDKNENNLLNLVREAEEPALFYAGVKAWMDVK
EGKPIGYPVALDATSSGLQILACLTGDRRAAELCNVVNYRDESGKVKRRDAYTVIYNKML
NTLGKGARIKRNDCKQAIMTALYGSEAKPKE
Structures of the domain Q8LTE3 4-154
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6c2p X-ray 2.7 B 8-148 None
6c2j X-ray 2.5 B 8-148 None
6c2l X-ray 3.2 B 8-148 None


© NPIDB team 2003 - 2019

text