Pfam domain
Pfam family: LAG1-DNAbind (PF09271.10)
Uniprot AC: Q8MXE7
RecName: Lin-12 And Glp-1 phenotype
Begin-End: 215-378
Organism: Caenorhabditis elegans
Interaction Mode:  L-Bb L-Mj 

Sequence:
ISIFHAKVAQKSYGNEKRFFCPPPCIYLIGQGWKLKKDRVAQLYKTLKASAQKDAAIEND
PIHEQQATELVAYIGIGSDTSERQQLDFSTGKVRHPGDQRQDPNIYDYCAAKTLYISDSD
KRKYFDLNAQFFYGCGMEIGGFVSQRIKVISKPSKKKQSMKNTD
Structures of the domain Q8MXE7 215-378
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ttu X-ray 2.85 A 217-380  L-Bb L-Mj 
2fo1 X-ray 3.12 A 217-380  L-Bb L-Mj 
3brd X-ray 2.21 A 217-382  L-Bb L-Mj 


© NPIDB team 2003 - 2020

text