Pfam domain
Pfam family: BTD (PF09270.9)
Uniprot AC: Q8MXE7
RecName: Lin-12 And Glp-1 phenotype
Begin-End: 382-534
Organism: Caenorhabditis elegans
Interaction Mode:  H-Bb S-Bb L-Bb L-Mn 

Sequence:
LCIASGTKVALFNRLRSQTVSTRYLHVEGNAFHASSTKWGAFTIHLFDDERGLQETDNFA
VRDGFVYYGSVVKLVDSVTGIALPRLRIRKVDKQQVILDASCSEEPVSQLHKCAFQMIDN
ELVYLCLSHDKIIQHQATAINEHRHQINDGAAW
Structures of the domain Q8MXE7 382-534
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ttu X-ray 2.85 A 384-536  S-Bb L-Bb L-Mn 
2fo1 X-ray 3.12 A 384-536  S-Bb L-Mn 
3brd X-ray 2.21 A 384-536  H-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2020

text