Pfam domain
Pfam family: FtsJ (PF01728.18)
Uniprot AC: Q8N1G2
RecName: Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1
Begin-End: 232-449
Organism: Homo sapiens
Interaction Mode:   

Sequence:
FLNRAAMKMANMDFVFDRMFTNPRDSYGKPLVKDREAELLYFADVCAGPGGFSEYVLWRK
KWHAKGFGMTLKGPNDFKLEDFYSASSELFEPYYGEGGIDGDGDITRPENISAFRNFVLD
NTDRKGVHFLMADGGFSVEGQENLQEILSKQLLLCQFLMALSIVRTGGHFICKTFDLFTP
FSVGLVYLLYCCFERVCLFKPITSRPANSERYVVCKGL
Structures of the domain Q8N1G2 232-449
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4n48 X-ray 2.7 B 233-448 None
4n48 X-ray 2.7 A 233-448 None


© NPIDB team 2003 - 2019

text