Pfam domain
Pfam family: CENP-S (PF15630.8)
Uniprot AC: Q8N2Z9
RecName: Centromere protein S
Begin-End: 17-92
Organism: Homo sapiens
Interaction Mode:   

Sequence:
QRLKAAVHYTVGCLCEEVALDKEMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTT
INTEDVKLLARRSNSL
Structures of the domain Q8N2Z9 17-92
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4ndy X-ray 7 I 17-92 None
4ndy X-ray 7 J 17-92 None
4ndy X-ray 7 K 17-92 None
4ndy X-ray 7 T 17-92 None
4ndy X-ray 7 Q 17-92 None
4ndy X-ray 7 R 17-92 None
4ndy X-ray 7 A 17-92 None
4ndy X-ray 7 S 17-92 None
4ndy X-ray 7 C 17-92 None
4ndy X-ray 7 G 17-92 None
4ne1 X-ray 6.5 A 17-92 None
4ne1 X-ray 6.5 I 17-92 None
4ne1 X-ray 6.5 J 17-92 None
4ne1 X-ray 6.5 K 17-92 None
4ne1 X-ray 6.5 Q 17-92 None
4ne1 X-ray 6.5 R 17-92 None
4ne1 X-ray 6.5 S 17-92 None
4ne1 X-ray 6.5 T 4-92 None
4ne1 X-ray 6.5 C 17-92 None
4ne1 X-ray 6.5 G 17-92 None
4ne1 X-ray 6.5 n 11-92 None
4ne1 X-ray 6.5 m 11-92 None
4ne1 X-ray 6.5 l 11-92 None
4ne1 X-ray 6.5 k 17-92 None
4ne1 X-ray 6.5 g 17-92 None
4ne1 X-ray 6.5 f 4-92 None
4ne1 X-ray 6.5 e 4-92 None
4ne1 X-ray 6.5 c 17-92 None
4ne1 X-ray 6.5 a 17-92 None
4ne1 X-ray 6.5 Y 17-92 None


© NPIDB team 2003 - 2021

text