Pfam domain
Pfam family: Mab-21 (PF03281.16)
Uniprot AC: Q8N884
RecName: Cyclic GMP-AMP synthase
Begin-End: 214-510
Organism: Homo sapiens
Interaction Mode:  H-Bb L-Bb 

Sequence:
YYEHVKISAPNEFDVMFKLEVPRIQLEEYSNTRAYYFVKFKRNPKENPLSQFLEGEILSA
SKMLSKFRKIIKEEINDIKDTDVIMKRKRGGSPAVTLLISEKISVDITLALESKSSWPAS
TQEGLRIQNWLSAKVRKQLRLKPFYLVPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKS
KTCCENKEEKCCRKDCLKLMKYLLEQLKERFKDKKHLDKFSSYHVKTAFFHVCTQNPQDS
QWDRKDLGLCFDNCVTYFLQCLRTEKLENYFIPEFNLFSSNLIDKRSKEFLTKQIEY
Structures of the domain Q8N884 214-510
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6cta X-ray 2.78 A 214-510  H-Bb 
6y5d X-ray 4.1 K 214-510  H-Bb 
6y5d X-ray 4.1 L 214-510  H-Bb L-Bb L-Mn 
6edc X-ray 2.71 A 214-510  H-Bb 
6ct9 X-ray 2.26 A 214-510  H-Bb L-Bb 
7ccr X-ray 4.9 K 211-510 None
7ccr X-ray 4.9 V 211-510 None
6edb X-ray 3.21 A 214-510  H-Bb L-Bb 
6y5e X-ray 3.15 K 214-510  H-Bb 
7ccq X-ray 3.8 K 211-510 None
7c0m X-ray 3.9 K 214-510  H-Bb L-Bb L-Mn 
7c0m X-ray 3.9 k 214-510 None


© NPIDB team 2003 - 2021

text