Pfam domain
Pfam family: PRP38 (PF03371.14)
Uniprot AC: Q8NAV1
RecName: Pre-mRNA-splicing factor 38A
Begin-End: 10-175
Organism: Homo sapiens
Interaction Mode:   

Sequence:
HSIHGTNPQYLVEKIIRTRIYESKYWKEECFGLTAELVVDKAMELRFVGGVYGGNIKPTP
FLCLTLKMLQIQPEKDIIVEFIKNEDFKYVRMLGALYMRLTGTAIDCYKYLEPLYNDYRK
IKSQNRNGEFELMHVDEFIDELLHSERVCDIILPRLQKRYVLEEAE
Structures of the domain Q8NAV1 10-175
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5o9z X-ray 4.5 I 14-174 None


© NPIDB team 2003 - 2019

text