Pfam domain
Pfam family: HhH-GPD (PF00730.24)
Uniprot AC: Q8R5T9
RecName: 3-Methyladenine DNA glycosylase
Begin-End: 119-265
Organism: Caldanaerobacter subterraneus subsp. tengcongensis
Interaction Mode:   

Sequence:
VSFIVSQNNRIPQIKKVIENLATSFGNPIEYKGKIYYTFPKPEELVMYDVETIAKTRCGF
RAKYIFDAASKVFSGEINLLKLHEYSTSEIRDILMTINGVGPKVADCVILYSIGRYDTFP
TDVWIKRIVEHLYLKREGTPVEIQLFA
Structures of the domain Q8R5T9 119-265
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4ejy X-ray 2 B 119-256 None
4ejy X-ray 2 A 119-256 None
4ejz X-ray 3.05 B 119-256 None
4ejz X-ray 3.05 A 119-256 None


© NPIDB team 2003 - 2019

text