Pfam domain
Pfam family: OGG_N (PF07934.11)
Uniprot AC: Q8R5T9
RecName: 3-Methyladenine DNA glycosylase
Begin-End: 13-118
Organism: Caldanaerobacter subterraneus subsp. tengcongensis
Interaction Mode:   

Sequence:
IVRGIADFNLKETFESGQCFRWNEEEDGSYTGVAYDRVVNVKLEGDTLIIDNTNLTDFYD
IWFDYFDLGRDYGQIKESLSKDPVLKEAIKFGQGIRILRQDTWETL
Structures of the domain Q8R5T9 13-118
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4ejy X-ray 2 B 19-118 None
4ejy X-ray 2 A 19-118 None
4ejz X-ray 3.05 B 19-118 None
4ejz X-ray 3.05 A 19-118 None


© NPIDB team 2003 - 2019

text