Pfam domain
Pfam family: N6_Mtase (PF02384.15)
Uniprot AC: Q8R9Q4
RecName: Type I restriction-modification system methyltransferase subunit
Begin-End: 143-462
Organism: Caldanaerobacter subterraneus subsp. tengcongensis
Interaction Mode:   

Sequence:
SQDDIFTVSQVYEELLRRLGNENRLAGEFYTPRPVVRFVVELVDPQIGEAVYDPACGTCG
FLVEAYLWMKQKERTIEDHRILQERTFFGQEKKPVPAFLGLVNMMLHGVTVPRVMRRNTL
EENIRNVSERFDVVVTNPPFGGTEGRHIQQNFPIQSNATELLFLQHIMKKLKPRDGARCG
MVVPEGTLFRGGAFAEVKRDLLEQFNLHTVVSLPPGTFAPYSDVKTALIFFERPGPTKEI
WYYELPLPEGLKKFSKGNPIQDEHFEEARKLWRGWDAYRKGLGPVEACLSERSWIVPVEE
VKKRGYDLTARNPNRSGGEE
Structures of the domain Q8R9Q4 143-462
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ybb X-ray 3.2 B 149-455 None
5ybb X-ray 3.2 A 149-455 None


© NPIDB team 2003 - 2020

text