Pfam domain
Pfam family: RNA_pol_Rpb1_4 (PF05000.16)
Uniprot AC: Q8RQE8
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 1017-1069
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
FNPLYVMAQSGARGNPQQIRQLCGLRGLMQKPSGETFEVPVRSSFREGLTVLE
Structures of the domain Q8RQE8 1017-1069
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5x22 X-ray 3.35 D 954-1050 None


© NPIDB team 2003 - 2019

text